IGHA2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
IGHA2 MaxPab polyclonal antibody. Western Blot analysis of IGHA2 expression in human colon.
Western Blot (Cell lysate)
IGHA2 MaxPab polyclonal antibody. Western Blot analysis of IGHA2 expression in Hela S3 NE.
Western Blot (Transfected lysate)
Western Blot analysis of IGHA2 expression in transfected 293T cell line (H00003494-T01) by IGHA2 MaxPab polyclonal antibody.
Lane 1: IGHA2 transfected lysate(52.47 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to IGHA2 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human IGHA2 protein.
Immunogen
IGHA2 (AAH73765.1, 1 a.a. ~ 477 a.a) full-length human protein.
Sequence
MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQTAGKGLEWIGYISHSGSTTYNPSLKSRVTLSLDTSKNQFSLRLNSVTAADTAVYYCAHGSSWDFAFDYWGQGTLVTVSSASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
IGHA2 MaxPab polyclonal antibody. Western Blot analysis of IGHA2 expression in human colon.Western Blot (Cell lysate)
IGHA2 MaxPab polyclonal antibody. Western Blot analysis of IGHA2 expression in Hela S3 NE.Western Blot (Transfected lysate)
Western Blot analysis of IGHA2 expression in transfected 293T cell line (H00003494-T01) by IGHA2 MaxPab polyclonal antibody.
Lane 1: IGHA2 transfected lysate(52.47 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to IGHA2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — IGHA2
Entrez GeneID
3494GeneBank Accession#
BC073765.1Protein Accession#
AAH73765.1Gene Name
IGHA2
Gene Alias
-
Gene Description
immunoglobulin heavy constant alpha 2 (A2m marker)
Omim ID
147000Gene Ontology
HyperlinkOther Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com