FOXA2 monoclonal antibody (M07), clone 4C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
FOXA2 monoclonal antibody (M07), clone 4C2. Western Blot analysis of FOXA2 expression in human pancreas.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXA2 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to FOXA2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.19 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FOXA2.
Immunogen
FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FOXA2 monoclonal antibody (M07), clone 4C2. Western Blot analysis of FOXA2 expression in human pancreas.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXA2 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to FOXA2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — FOXA2
Entrez GeneID
3170GeneBank Accession#
NM_021784Protein Accession#
NP_068556Gene Name
FOXA2
Gene Alias
HNF3B, MGC19807, TCF3B
Gene Description
forkhead box A2
Omim ID
600288Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000030409|OTTHUMP00000030410|hepatic nuclear factor-3-beta|hepatocyte nuclear factor 3, beta
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com