HMGA1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human HMGA1 protein.
Immunogen
HMGA1 (AAH04924, 1 a.a. ~ 96 a.a) full-length human protein.
Sequence
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HMGA1 expression in transfected 293T cell line (H00003159-T01) by HMGA1 MaxPab polyclonal antibody.
Lane 1: HMGA1 transfected lysate(10.56 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to HMGA1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — HMGA1
Entrez GeneID
3159GeneBank Accession#
BC004924Protein Accession#
AAH04924Gene Name
HMGA1
Gene Alias
HMG-R, HMGA1A, HMGIY, MGC12816, MGC4242, MGC4854
Gene Description
high mobility group AT-hook 1
Omim ID
600701Gene Ontology
HyperlinkGene Summary
This gene encodes a non-histone protein involved in many cellular processes, including regulation of inducible gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of A+T-rich regions in double-stranded DNA. It has little secondary structure in solution but assumes distinct conformations when bound to substrates such as DNA or other proteins. The encoded protein is frequently acetylated and is found in the nucleus. At least seven transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000016222|OTTHUMP00000016223|OTTHUMP00000016224|OTTHUMP00000039618|high-mobility group (nonhistone chromosomal) protein isoforms I and Y|nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y
-
Interactome
-
Disease
-
Publication Reference
-
Differential expression and prognostic value of HMGA1 in pancreatic head and periampullary cancer.
van der Zee JA, Ten Hagen TL, Hop WC, van Dekken H, Dicheva BM, Seynhaeve AL, Koning GA, Eggermont AM, van Eijck CH.
European Journal of Cancer 2010 Dec; 46(18):3393.
Application:IHC-P, Human, Human pancreatic head and periampullary cancer.
-
Differential expression and prognostic value of HMGA1 in pancreatic head and periampullary cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com