HLA-DRB1 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human HLA-DRB1 protein.
Immunogen
HLA-DRB1 (AAH33827.1, 1 a.a. ~ 266 a.a) full-length human protein.
Sequence
MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HLA-DRB1 MaxPab polyclonal antibody. Western Blot analysis of HLA-DRB1 expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of HLA-DRB1 expression in transfected 293T cell line (H00003123-T03) by HLA-DRB1 MaxPab polyclonal antibody.
Lane 1: HLA-DRB1 transfected lysate(29.26 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HLA-DRB1
Entrez GeneID
3123GeneBank Accession#
BC033827.1Protein Accession#
AAH33827.1Gene Name
HLA-DRB1
Gene Alias
DRB1, FLJ76359, HLA-DR1B, HLA-DRB, HLA-DRB1*, SS1
Gene Description
major histocompatibility complex, class II, DR beta 1
Gene Ontology
HyperlinkGene Summary
HLA-DRB1 belongs to the HLA class II beta chain paralogs. The class II molecule is a heterodimer consisting of an alpha (DRA) and a beta chain (DRB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa. It is encoded by 6 exons. Exon one encodes the leader peptide; exons 2 and 3 encode the two extracellular domains; exon 4 encodes the transmembrane domain; and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Hundreds of DRB1 alleles have been described and typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogs DRB3, DRB4 and DRB5. DRB1 is present in all individuals. Allelic variants of DRB1 are linked with either none or one of the genes DRB3, DRB4 and DRB5. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9. [provided by RefSeq
Other Designations
HLA class II antigen beta chain|HLA class II histocompatibility antigen, DR-1 beta chain|HLA-DR-beta 1|MHC class II HLA-DR beta 1 chain|MHC class II HLA-DR-beta cell surface glycoprotein|MHC class II antigen HLA-DR13|human leucocyte antigen DRB1|leucocyte
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Renal mTORC1 activation is associated with disease activity and prognosis in lupus nephritis.
Zhaomin Mao, Ying Tan, Juan Tao, Linlin Li , Hui Wang, Feng Yu, Andras Perl, Minghui Zhao.
Rheumatology (Oxford, England) 2022 Jan; keac037.
Application:IF, Human, Renal sections.
-
A Modified Peptide Derived from Goodpasture Autoantigen Arrested and Attenuated Kidney Injuries in a Rat Model of Anti-GBM Glomerulonephritis.
Shi Y, Jia XY, Gu QH, Wang M, Cui Z, Zhao MH.
Journal of the American Society of Nephrology 2020 Jan; 31(1):40.
Application:Flow Cyt, Human, Human B cells.
-
The critical amino acids of a nephritogenic epitope on human Goodpasture autoantigen for binding to HLA-DRB1*1501.
Gu QH, Jia XY, Li JN, Chen FJ, Cui Z, Zhao MH.
Molecular Immunology 2017 May; 88:1.
Application:Flow Cyt, Peptides.
-
DRB1*15 Allele Is a Risk Factor for PR3-ANCA Disease in African Americans.
Cao Y, Schmitz JL, Yang J, Hogan SL, Bunch D, Hu Y, Jennette CE, Berg EA, Arnett FC Jr, Jennette JC, Falk RJ, Preston GA.
Journal of the American Society of Nephrology 2011 Jun; 22(6):1161.
Application:ELISA, Flow Cyt, Human, MGAR cells, Neutrophils.
-
Renal mTORC1 activation is associated with disease activity and prognosis in lupus nephritis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com