HLA-C MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human HLA-C protein.
Immunogen
HLA-C (AAH02463.1, 1 a.a. ~ 366 a.a) full-length human protein.
Sequence
MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HLA-C expression in transfected 293T cell line (H00003107-T01) by HLA-C MaxPab polyclonal antibody.
Lane 1: HLA-C transfected lysate(40.80 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of HLA-C transfected lysate using anti-HLA-C MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with HLA-C purified MaxPab mouse polyclonal antibody (B01P) (H00003107-B01P). -
Gene Info — HLA-C
Entrez GeneID
3107GeneBank Accession#
BC002463Protein Accession#
AAH02463.1Gene Name
HLA-C
Gene Alias
D6S204, FLJ27082, HLA-Cw, HLA-Cw12, HLA-JY3, HLC-C, PSORS1
Gene Description
major histocompatibility complex, class I, C
Gene Ontology
HyperlinkGene Summary
HLA-C belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Over one hundred HLA-C alleles have been described [provided by RefSeq
Other Designations
HLA class I antigen|HLA class I heavy chain|HLA class I histocompatibility antigen, C alpha chain|HLA-C (Cw*1201)|HLA-Cw*050x|MHC class I HLA-C|MHC class I HLA-Cw*0803|MHC class I antigen HLA-C|MHC class I antigen heavy chain HLA-C|MHC class I protein HLA
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com