HLA-A MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human HLA-A protein.
Immunogen
HLA-A (NP_002107.3, 1 a.a. ~ 365 a.a) full-length human protein.
Sequence
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (67)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HLA-A MaxPab rabbit polyclonal antibody. Western Blot analysis of HLA-A expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of HLA-A expression in transfected 293T cell line (H00003105-T02) by HLA-A MaxPab polyclonal antibody.
Lane 1: HLA-A transfected lysate(40.8 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of HLA-A transfected lysate using anti-HLA-A MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with HLA-A purified MaxPab mouse polyclonal antibody (B01P) (H00003105-B01P).Immunofluorescence
Immunofluorescence of purified MaxPab antibody to HLA-A on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — HLA-A
Entrez GeneID
3105GeneBank Accession#
NM_002116Protein Accession#
NP_002107.3Gene Name
HLA-A
Gene Alias
HLAA
Gene Description
major histocompatibility complex, class I, A
Gene Ontology
HyperlinkGene Summary
HLA-A belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-A alleles have been described. [provided by RefSeq
Other Designations
HLA class I histocompatibility antigen, A-23 alpha chain|MHC class I antigen HLA-A heavy chain|MHC leukocyte antigen|OTTHUMP00000161059|antigen presenting molecule|leucocyte antigen class I|leukocyte antigen class I-A
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com