H3F3B monoclonal antibody (M01), clone 2D7-H1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant H3F3B.
Immunogen
H3F3B (AAH17558, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (40.7 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of H3F3B expression in transfected 293T cell line by H3F3B monoclonal antibody (M01), clone 2D7-H1.
Lane 1: H3F3B transfected lysate(15 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to H3F3B on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged H3F3B is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to H3F3B on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — H3F3B
Entrez GeneID
3021GeneBank Accession#
BC017558Protein Accession#
AAH17558Gene Name
H3F3B
Gene Alias
H3.3B, H3F3A
Gene Description
H3 histone, family 3B (H3.3B)
Omim ID
601058Gene Ontology
HyperlinkGene Summary
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is poyadenylated, unlike most histone genes. The protein encoded is a member of the histone H3 family. [provided by RefSeq
Other Designations
H3 histone, family 3A|H3 histone, family 3B
-
Interactome
-
Pathway
-
Publication Reference
-
A knockout-first model of H3f3a gene targeting leads to developmental lethality.
Kelly Bush, Vanessa Cervantes, Jennifer Q Yee, Rachel H Klein, Paul S Knoepfler.
Genesis (New York, N.Y. : 2000) 2023 Mar; 61(1-2):e23507.
Application:WB, Mouse, MEFs, Neurosphere.
-
ARID1A-dependent maintenance of H3.3 is required for repressive CHD4-ZMYND8 chromatin interactions at super-enhancers.
Jake J Reske, Mike R Wilson, Brooke Armistead, Shannon Harkins, Cristina Perez, Joel Hrit, Marie Adams, Scott B Rothbart, Stacey A Missmer, Asgerally T Fazleabas, Ronald L Chandler.
BMC Biology 2022 Sep; 20(1):209.
Application:WB-Tr, Human, 12Z cells.
-
Distinct role of histone chaperone Asf1a and Asf1b during fertilization and pre-implantation embryonic development in mice.
Xuemei Wang, Lu Wang, Jie Dou, Tianjiao Yu, Pengbo Cao, Na Fan, Uyunbilig Borjigin, Buhe Nashun.
Epigenetics & Chromatin 2021 Dec; 14(1):55.
Application:IF, Mouse, Mouse embryo.
-
H2AK119ub1 guides maternal inheritance and zygotic deposition of H3K27me3 in mouse embryos.
Hailiang Mei, Chisayo Kozuka, Ryoya Hayashi, Mami Kumon, Haruhiko Koseki, Azusa Inoue.
Nature Genetics 2021 Apr; 53(4):539.
Application:IF, Mouse, Mouse oocytes, Mouse preimplantation embryos.
-
Characterization of H3.3 and HIRA expression and function in bovine early embryos.
Zhang K, Wang H, Rajput SK, Folger JK, Smith GW.
Molecular Reproduction and Development 2018 Feb; 85(2):106.
Application:IF, Bovine, Bovine oocytes and embryos.
-
Cooperative Binding of Transcription Factors Orchestrates Reprogramming.
Constantinos Chronis, Petko Fiziev, Bernadett Papp, Stefan Butz, Giancarlo Bonora, Shan Sabri, Jason Ernst, Kathrin Plath.
Cell 2017 Jan; 168(3):443.
Application:ChIP-Seq, Mouse, Mouse embryonic fibroblast.
-
EP400 Deposits H3.3 into Promoters and Enhancers during Gene Activation.
Pradhan SK, Su T, Yen L, Jacquet K, Huang C, Cote J, Kurdistani SK, Carey MF.
Molecular Cell 2016 Jan; 61(1):27.
Application:ChIP, Human, U2OS cells.
-
Chromatin and Transcription Transitions of Mammalian Adult Germline Stem Cells and Spermatogenesis.
Hammoud SS, Low DH, Yi C, Carrell DT, Guccione E, Cairns BR.
Cell Stem Cell 2014 Aug; 15(2):239.
Application:ChIP, Human, Sperm.
-
Histone variant H3.3 maintains a decondensed chromatin state essential for mouse preimplantation development.
Lin CJ, Conti M, Ramalho-Santos M.
Development 2013 Sep; 140(17):3624.
Application:IF, Mouse, Mouse embryos.
-
Drosophila Yemanuclein and HIRA Cooperate for De Novo Assembly of H3.3-Containing Nucleosomes in the Male Pronucleus.
Orsi GA, Algazeery A, Meyer RE, Capri M, Sapey-Triomphe LM, Horard B, Gruffat H, Couble P, Ait-Ahmed O, Loppin B.
PLOS Genetics 2013 Feb; 9(2):e1003285.
Application:IFA, Drosophila, Egg.
-
HIRA dependent H3.3 deposition is required for transcriptional reprogramming following nuclear transfer to Xenopus oocytes.
Jullien J, Astrand C, Szenker E, Garrett N, Almouzni G, Gurdon JB.
Epigenetics & Chromatin 2012 Oct; 5(1):17.
Application:IF, WB, Xenopus, Xenopus oocytes.
-
A developmental requirement for HIRA-dependent H3.3 deposition revealed at gastrulation in Xenopus.
Szenker E, Lacoste N, Almouzni G.
Cell Reports 2012 Jun; 1(6):730.
Application:WB, Frog, Frog fertilized eggs.
-
The death-associated protein DAXX is a novel histone chaperone involved in the replication-independent deposition of H3.3.
Drane P, Ouararhni K, Depaux A, Shuaib M, Hamiche A.
Genes & Development 2010 Jun; 24(12):1253.
Application:WB, Human, HeLa cells.
-
A knockout-first model of H3f3a gene targeting leads to developmental lethality.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com