GSTP1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GSTP1 protein.
Immunogen
GSTP1 (AAH10915.1, 1 a.a. ~ 210 a.a) full-length human protein.
Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Rat (86)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GSTP1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in human kidney.Western Blot (Tissue lysate)
GSTP1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in mouse liver.Western Blot (Cell lysate)
GSTP1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of GSTP1 expression in transfected 293T cell line (H00002950-T01) by GSTP1 MaxPab polyclonal antibody.
Lane 1: GSTP1 transfected lysate(23.30 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between GSTP1 and MAPK8. HeLa cells were stained with anti-GSTP1 rabbit purified polyclonal 1:1200 and anti-MAPK8 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — GSTP1
Entrez GeneID
2950GeneBank Accession#
BC010915.1Protein Accession#
AAH10915.1Gene Name
GSTP1
Gene Alias
DFN7, FAEES3, GST3, PI
Gene Description
glutathione S-transferase pi 1
Omim ID
134660Gene Ontology
HyperlinkGene Summary
Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq
Other Designations
OTTHUMP00000174659|deafness, X-linked 7|fatty acid ethyl ester synthase III|glutathione transferase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Phosphorylation of Glutathione S-Transferase P1 (GSTP1) by Epidermal Growth Factor Receptor (EGFR) Promotes Formation of the GSTP1-c-Jun N-terminal kinase (JNK) Complex and Suppresses JNK Downstream Signaling and Apoptosis in Brain Tumor Cells.
Okamura T, Antoun G, Keir ST, Friedman H, Bigner DD, Ali-Osman F.
The Journal of Biological Chemistry 2015 Dec; 290(52):30866.
Application:PLA, Human, UW228 cells.
-
Phosphorylation of Glutathione S-Transferase P1 (GSTP1) by Epidermal Growth Factor Receptor (EGFR) Promotes Formation of the GSTP1-c-Jun N-terminal kinase (JNK) Complex and Suppresses JNK Downstream Signaling and Apoptosis in Brain Tumor Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com