GSTA4 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GSTA4 protein.
Immunogen
GSTA4 (NP_001503.1, 1 a.a. ~ 222 a.a) full-length human protein.
Sequence
MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GSTA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTA4 expression in mouse spleen.Western Blot (Tissue lysate)
GSTA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTA4 expression in human placenta.Western Blot (Cell lysate)
GSTA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTA4 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of GSTA4 expression in transfected 293T cell line (H00002941-T03) by GSTA4 MaxPab polyclonal antibody.
Lane 1: GSTA4 transfected lysate(25.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GSTA4
Entrez GeneID
2941GeneBank Accession#
NM_001512.2Protein Accession#
NP_001503.1Gene Name
GSTA4
Gene Alias
DKFZp686D21185, GSTA4-4, GTA4
Gene Description
glutathione S-transferase alpha 4
Omim ID
605450Gene Ontology
HyperlinkGene Summary
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. [provided by RefSeq
Other Designations
GST class-alpha|OTTHUMP00000016624|OTTHUMP00000016625|S-(hydroxyalkyl)glutathione lyase A4|glutathione S-alkyltransferase A4|glutathione S-aralkyltransferase A4|glutathione S-aryltransferase A4|glutathione S-transferase A4|glutathione transferase A4-4
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Glutathione S-transferase alpha 4 induction by activator protein 1 in colorectal cancer.
Yang Y, Huycke MM, Herman TS, Wang X.
Oncogene 2016 Apr; 35(44):5795.
Application:WB, IHC, Human, Mouse, Human Caco2, DLD1, Hct116, HT29, LoVo, RKO FHC and Mouse YAMC, RAW264.7, Mouse colon.
-
Glutathione S-transferase alpha 4 induction by activator protein 1 in colorectal cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com