GAGE1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GAGE1 protein.
Immunogen
GAGE1 (NP_001459.2, 1 a.a. ~ 139 a.a) full-length human protein.
Sequence
MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQTGILWLLMNNCFLNLSPRKP
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GAGE1 expression in transfected 293T cell line (H00002543-T01) by GAGE1 MaxPab polyclonal antibody.
Lane 1: GAGE1 transfected lysate(15.29 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to GAGE1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] -
Gene Info — GAGE1
Entrez GeneID
2543GeneBank Accession#
NM_001468.3Protein Accession#
NP_001459.2Gene Name
GAGE1
Gene Alias
MGC33825
Gene Description
G antigen 1
Omim ID
300594Gene Ontology
HyperlinkGene Summary
This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The GAGE1 cDNA contains a 143-bp insertion, located in the coding sequence near the termination codon, that is absent from the other cDNAs.The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein. An alternatively spliced transcript variant has been found for this gene. [provided by RefSeq
Other Designations
MZ2-F antigen|OTTHUMP00000025848
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com