F3 monoclonal antibody (M01A), clone 4G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant F3.
Immunogen
F3 (AAH11029, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (61); Rat (59)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
F3 monoclonal antibody (M01A), clone 4G4. Western Blot analysis of F3 expression in Jurkat.Western Blot (Cell lysate)
F3 monoclonal antibody (M01A), clone 4G4 Western Blot analysis of F3 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of F3 expression in transfected 293T cell line by F3 monoclonal antibody (M01A), clone 4G4.
Lane 1: F3 transfected lysate(33.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — F3
Entrez GeneID
2152GeneBank Accession#
BC011029Protein Accession#
AAH11029Gene Name
F3
Gene Alias
CD142, TF, TFA
Gene Description
coagulation factor III (thromboplastin, tissue factor)
Omim ID
134390Gene Ontology
HyperlinkGene Summary
This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. [provided by RefSeq
Other Designations
OTTHUMP00000012426|coagulation factor III|tissue factor
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Enhanced tissue factor expression by blood eosinophils from patients with hypereosinophilia: a possible link with thrombosis.
Cugno M, Marzano AV, Lorini M, Carbonelli V, Tedeschi A.
PLoS One 2014 Nov; 9(11):e111862.
Application:WB-Ce, Human, Eosinophils, ECV304, IMR90 cells.
-
Enhanced tissue factor expression by blood eosinophils from patients with hypereosinophilia: a possible link with thrombosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com