ERBB2 monoclonal antibody (M05), clone 3B1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ERBB2.
Immunogen
ERBB2 (NP_004439, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ERBB2 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ERBB2 is 0.3 ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between ERBB3 and ERBB2. HeLa cells were stained with anti-ERBB3 rabbit purified polyclonal 1:1200 and anti-ERBB2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to ERBB2 on MCF-7 cell . [antibody concentration 10 ug/ml]Immunofluorescence
Immunofluorescence of monoclonal antibody to ERBB2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — ERBB2
Entrez GeneID
2064GeneBank Accession#
NM_004448Protein Accession#
NP_004439Gene Name
ERBB2
Gene Alias
CD340, HER-2, HER-2/neu, HER2, NEU, NGL, TKR1
Gene Description
v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized. [provided by RefSeq
Other Designations
c-erb B2/neu protein|erbB-2|herstatin|neuroblastoma/glioblastoma derived oncogene homolog|v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2 (neuro/glioblastoma derived oncogene homolog)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com