EPHB6 monoclonal antibody (M03), clone 5D8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EPHB6.
Immunogen
EPHB6 (NP_004436, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEE
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EPHB6 monoclonal antibody (M03), clone 5D8 Western Blot analysis of EPHB6 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
EPHB6 monoclonal antibody (M03), clone 5D8. Western Blot analysis of EPHB6 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EPHB6 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPHB6 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — EPHB6
Entrez GeneID
2051GeneBank Accession#
NM_004445Protein Accession#
NP_004436Gene Name
EPHB6
Gene Alias
HEP, MGC129910, MGC129911
Gene Description
EPH receptor B6
Omim ID
602757Gene Ontology
HyperlinkGene Summary
Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The ephrin receptor encoded by this gene lacks the kinase activity of most receptor tyrosine kinases and binds to ephrin-B ligands. [provided by RefSeq
Other Designations
ephrin receptor EphB6
-
Interactome
-
Pathway
-
Publication Reference
-
Ephrin/Eph receptor interaction facilitates macrophage recognition of differentiating human erythroblasts.
Hampton-O'Neil LA, Severn CE, Cross SJ, Gurung S, Nobes CD, Toye AM.
Haematologica 2019 Jun; [Epub].
Application:WB-Tr, Human, HEK 293T, HeLa cells, Erythroblasts.
-
Dynamic Interactions between Cancer Cells and the Embryonic Microenvironment Regulate Cell Invasion and Reveal EphB6 as a Metastasis Suppressor.
Bailey CM, Kulesa PM.
Molecular Cancer Research 2014 Sep; 12(9):1303.
Application:WB, Human, C8161 cells.
-
Ephrin/Eph receptor interaction facilitates macrophage recognition of differentiating human erythroblasts.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com