EPB41 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (38.21 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant EPB41.
Immunogen
EPB41 (AAH39079, 116 a.a. ~ 225 a.a) partial recombinant protein with GST tag.
Sequence
IEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECV
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — EPB41
Entrez GeneID
2035GeneBank Accession#
BC039079Protein Accession#
AAH39079Gene Name
EPB41
Gene Alias
4.1R, EL1, HE
Gene Description
erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked)
Omim ID
130500Gene Ontology
HyperlinkGene Summary
Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes and a variable degree of hemolytic anemia. Inherited as an autosomal dominant, elliptocytosis results from mutation in any one of several genes encoding proteins of the red cell membrane skeleton. The form discussed here is the one found in the 1950s to be linked to Rh blood group and more recently shown to be caused by a defect in protein 4.1. 'Rh-unlinked' forms of elliptocytosis are caused by mutation in the alpha-spectrin gene (MIM 182860), the beta-spectrin gene (MIM 182870), or the band 3 gene (MIM 109270).[supplied by OMIM
Other Designations
OTTHUMP00000003772|OTTHUMP00000003773|OTTHUMP00000003774|erythrocyte surface protein band 4.1
-
Interactome
-
Pathway
-
Publication Reference
-
Spectrin and Other Membrane-Skeletal Components in Human Red Blood Cells of Different Age.
Ciana A, Achilli C, Minetti G.
Cellular Physiology and Biochemistry 2017 Jun; 42(3):1139.
Application：WB-Ce, Human, Human red blood cells.
-
Freely turning over palmitate in erythrocyte membrane proteins is not responsible for the anchoring of lipid rafts to the spectrin skeleton: a study with bio-orthogonal chemical probes.
Ciana A, Achilli C, Hannoush RN, Risso A, Balduini C, Minetti G.
Biochimica et Biophysica Acta 2013 Mar; 1828(3):924.
Application：WB-Ce, Human, Detergent-Resistant-Membranes.
-
On the association of lipid rafts to the spectrin skeleton in human erythrocytes.
Ciana A, Achilli C, Balduini C, Minetti G.
Biochimica et Biophysica Acta 2011 Jan; 1808(1):183.
Application：WB, Human, Human erythrocytes.
-
Spectrin and Other Membrane-Skeletal Components in Human Red Blood Cells of Different Age.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com