ELAVL3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ELAVL3 MaxPab polyclonal antibody. Western Blot analysis of ELAVL3 expression in rat brain.
Western Blot (Transfected lysate)
Western Blot analysis of ELAVL3 expression in transfected 293T cell line (H00001995-T01) by ELAVL3 MaxPab polyclonal antibody.
Lane 1: ELAVL3 transfected lysate(40.48 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ELAVL3 protein.
Immunogen
ELAVL3 (AAH11875, 1 a.a. ~ 367 a.a) full-length human protein.
Sequence
MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAIDTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPRTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKTGQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAAGAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFKTSKQHKA
Host
Mouse
Reactivity
Human, Rat
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ELAVL3 MaxPab polyclonal antibody. Western Blot analysis of ELAVL3 expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of ELAVL3 expression in transfected 293T cell line (H00001995-T01) by ELAVL3 MaxPab polyclonal antibody.
Lane 1: ELAVL3 transfected lysate(40.48 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ELAVL3
Entrez GeneID
1995GeneBank Accession#
BC014144Protein Accession#
AAH11875Gene Name
ELAVL3
Gene Alias
DKFZp547J036, HUC, HUCL, MGC20653, PLE21
Gene Description
ELAV (embryonic lethal, abnormal vision, Drosophila)-like 3 (Hu antigen C)
Omim ID
603458Gene Ontology
HyperlinkGene Summary
A member of the ELAVL protein family, ELAV-like 3 is a neural-specific RNA-binding protein which contains three RNP-type RNA recognition motifs. The observation that ELAVL3 is one of several Hu antigens (neuronal-specific RNA-binding proteins) recognized by the anti-Hu serum antibody present in sera from patients with paraneoplastic encephalomyelitis and sensory neuronopathy (PEM/PSN) suggests it has a role in neurogenesis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
ELAV-like protein 3|Hu antigen C|paraneoplastic cerebellar degeneration-associated antigen|paraneoplastic limbic encephalitis antigen 21
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com