ELA1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ELA1 expression in transfected 293T cell line (H00001990-T01) by ELA1 MaxPab polyclonal antibody.
Lane 1: ELA1 transfected lysate(28.38 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ELA1 protein.
Immunogen
ELA1 (NP_001962.3, 1 a.a. ~ 258 a.a) full-length human protein.
Sequence
MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIASN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ELA1 expression in transfected 293T cell line (H00001990-T01) by ELA1 MaxPab polyclonal antibody.
Lane 1: ELA1 transfected lysate(28.38 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ELA1
Entrez GeneID
1990GeneBank Accession#
NM_001971.4Protein Accession#
NP_001962.3Gene Name
ELA1
Gene Alias
-
Gene Description
elastase 1, pancreatic
Omim ID
130120Gene Ontology
HyperlinkGene Summary
Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas or fecal material is actually referring to chymotrypsin-like elastase family, member 3B. [provided by RefSeq
Other Designations
pancreatic elastase I
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com