EGR2 monoclonal antibody (M03), clone 1G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
EGR2 monoclonal antibody (M03), clone 1G5. Western Blot analysis of EGR2 expression in rat brain.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EGR2 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.21 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EGR2.
Immunogen
EGR2 (NP_000390.2, 217 a.a. ~ 293 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPR
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.21 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
EGR2 monoclonal antibody (M03), clone 1G5. Western Blot analysis of EGR2 expression in rat brain.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EGR2 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — EGR2
Entrez GeneID
1959GeneBank Accession#
NM_000399Protein Accession#
NP_000390.2Gene Name
EGR2
Gene Alias
AT591, CMT1D, CMT4E, DKFZp686J1957, FLJ14547, KROX20
Gene Description
early growth response 2 (Krox-20 homolog, Drosophila)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
Other Designations
KROX-20, Drosophila, homolog (early growth response-2)|Krox-20 homolog|OTTHUMP00000062133|early growth response 2 protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com