TSC22D3 monoclonal antibody (M01), clone 3A5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TSC22D3 expression in transfected 293T cell line by TSC22D3 monoclonal antibody (M01), clone 3A5.
Lane 1: TSC22D3 transfected lysate(22.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TSC22D3 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of TSC22D3 transfected lysate using anti-TSC22D3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TSC22D3 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TSC22D3 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to TSC22D3 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TSC22D3.
Immunogen
TSC22D3 (NP_932174, 1 a.a. ~ 97 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TSC22D3 expression in transfected 293T cell line by TSC22D3 monoclonal antibody (M01), clone 3A5.
Lane 1: TSC22D3 transfected lysate(22.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TSC22D3 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of TSC22D3 transfected lysate using anti-TSC22D3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TSC22D3 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TSC22D3 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TSC22D3 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — TSC22D3
Entrez GeneID
1831GeneBank Accession#
NM_198057Protein Accession#
NP_932174Gene Name
TSC22D3
Gene Alias
DIP, DKFZp313A1123, DSIPI, GILZ, TSC-22R, hDIP
Gene Description
TSC22 domain family, member 3
Omim ID
300506Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene shares significant sequence identity with the murine TSC-22 and Drosophila shs, both of which are leucine zipper proteins, that function as transcriptional regulators. The expression of this gene is stimulated by glucocorticoids and interleukin 10, and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid and chemokine. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
DSIP-immunoreactive leucine zipper protein|OTTHUMP00000023811|OTTHUMP00000023813|OTTHUMP00000023814|TSC-22 related protein|delta sleep inducing peptide, immunoreactor|glucocorticoid-induced leucine zipper protein
-
Interactome
-
Disease
-
Publication Reference
-
PlexinB1 Promotes Nuclear Translocation of the Glucocorticoid Receptor.
Williamson M, Garg R, Wells CM.
Cells 2019 Dec; 9(1):E3.
Application：WB-Ce, Human, DU245, PC3 cells.
-
PlexinB1 Promotes Nuclear Translocation of the Glucocorticoid Receptor.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com