ATF2 monoclonal antibody (M09), clone 3A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAPK3 and ATF2. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-ATF2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ATF2.
Immunogen
ATF2 (NP_001871, 91 a.a. ~ 190 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVP*
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAPK3 and ATF2. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-ATF2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — ATF2
Entrez GeneID
1386GeneBank Accession#
NM_001880Protein Accession#
NP_001871Gene Name
ATF2
Gene Alias
CRE-BP1, CREB2, HB16, MGC111558, TREB7
Gene Description
activating transcription factor 2
Omim ID
123811Gene Ontology
HyperlinkGene Summary
This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element (CRE), an octameric palindrome. The protein forms a homodimer or heterodimer with c-Jun and stimulates CRE-dependent transcription. The protein is also a histone acetyltransferase (HAT) that specifically acetylates histones H2B and H4 in vitro; thus it may represent a class of sequence-specific factors that activate transcription by direct effects on chromatin components. Additional transcript variants have been identified but their biological validity has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000163262|activating transcription factor 2 splice variant ATF2-var2|cAMP responsive element binding protein 2, formerly
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com