CIDEA monoclonal antibody (M01), clone 4B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CIDEA expression in transfected 293T cell line by CIDEA monoclonal antibody (M01), clone 4B9.
Lane 1: CIDEA transfected lysate(28.3 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CIDEA transfected lysate using anti-CIDEA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CIDEA MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CIDEA is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (53.57 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CIDEA.
Immunogen
CIDEA (AAH31896, 1 a.a. ~ 253 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (53.57 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CIDEA expression in transfected 293T cell line by CIDEA monoclonal antibody (M01), clone 4B9.
Lane 1: CIDEA transfected lysate(28.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of CIDEA transfected lysate using anti-CIDEA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CIDEA MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CIDEA is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — CIDEA
Entrez GeneID
1149GeneBank Accession#
BC031896Protein Accession#
AAH31896Gene Name
CIDEA
Gene Alias
CIDE-A
Gene Description
cell death-inducing DFFA-like effector a
Omim ID
604440Gene Ontology
HyperlinkGene Summary
This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher metabolic rates, higher lipolysis in brown adipose tissue and higher core body temperatures when subjected to cold. These mice are also resistant to diet-induced obesity and diabetes. This suggests that in mice this gene product plays a role in thermogenesis and lipolysis. Two alternative transcripts encoding different isoforms have been identified. [provided by RefSeq
Other Designations
cell death activator
-
Interactome
-
Disease
-
Publication Reference
-
Beiging of perivascular adipose tissue regulates its inflammation and vascular remodeling.
Yusuke Adachi, Kazutaka Ueda, Seitaro Nomura, Kaoru Ito, Manami Katoh, Mikako Katagiri, Shintaro Yamada, Masaki Hashimoto, Bowen Zhai, Genri Numata, AkiraOtani, Munetoshi Hinata, Yuta Hiraike , Hironori Waki, Norifumi Takeda, Hiroyuki Morita, Tetsuo Ushiku, Toshimasa Yamauchi, Eiki Takimoto & Issei Komuro.
Nature Communications 2022 Sep; 13(1):5117.
Application：IHC, Human, Human aortic.
-
Immunotherapeutic potential of anti-human endogenous retrovirus-K envelope protein antibodies in targeting breast tumors.
Wang-Johanning F, Rycaj K, Plummer JB, Li M, Yin B, Frerich K, Garza JG, Shen J, Lin K, Yan P, Glynn SA, Dorsey TH, Hunt KK, Ambs S, Johanning GL.
Journal of the National Cancer Institute 2012 Feb; 104(3):189.
Application：WB-Ce, Human, MCF10A, MDA-MB-231, MDA-MB-453.
-
Differential regulation of CIDEA and CIDEC expression by insulin via Akt1/2- and JNK2-dependent pathways in human adipocytes.
Ito M, Nagasawa M, Omae N, Ide T, Akasaka Y, Murakami K.
Journal of Lipid Research 2011 Aug; 52(8):1450.
Application：WB-Tr, Human, Human adipocytes.
-
Differential roles of CIDEA and CIDEC in insulin-induced anti-apoptosis and lipid droplet formation in human adipocytes.
Ito M, Nagasawa M, Hara T, Ide T, Murakami K.
Journal of Lipid Research 2010 Jul; 51(7):1676.
Application：WB, Human, Adipocytes.
-
Beiging of perivascular adipose tissue regulates its inflammation and vascular remodeling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com