CETN1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CETN1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CETN1 expression in mouse kidney.
Western Blot (Transfected lysate)
Western Blot analysis of CETN1 expression in transfected 293T cell line (H00001068-T01) by CETN1 MaxPab polyclonal antibody.
Lane 1: CETN1 transfected lysate(19.60 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CETN1 protein.
Immunogen
CETN1 (NP_004057.1, 1 a.a. ~ 172 a.a) full-length human protein.
Sequence
MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CETN1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CETN1 expression in mouse kidney.Western Blot (Transfected lysate)
Western Blot analysis of CETN1 expression in transfected 293T cell line (H00001068-T01) by CETN1 MaxPab polyclonal antibody.
Lane 1: CETN1 transfected lysate(19.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CETN1
Entrez GeneID
1068GeneBank Accession#
NM_004066Protein Accession#
NP_004057.1Gene Name
CETN1
Gene Alias
CEN1, CETN
Gene Description
centrin, EF-hand protein, 1
Omim ID
603187Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq
Other Designations
Centrin-1|EF-hand protein|calcium binding protein|centrin 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com