CDKN2B (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CDKN2B full-length ORF ( AAH14469, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
40.92
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CDKN2B
Entrez GeneID
1030GeneBank Accession#
BC014469Protein Accession#
AAH14469Gene Name
CDKN2B
Gene Alias
CDK4I, INK4B, MTS2, P15, TP15, p15INK4b
Gene Description
cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Omim ID
600431Gene Ontology
HyperlinkGene Summary
This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq
Other Designations
CDK inhibitory protein|CDK4B inhibitor|OTTHUMP00000021154|OTTHUMP00000021155|cyclin-dependent kinase 4 inhibitor B|cyclin-dependent kinase inhibitor 2B|cyclin-dependent kinases 4 and 6 binding protein|multiple tumor suppressor 2|p14_CDK inhibitor|p14_INK4
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com