CDKN2A monoclonal antibody (M06), clone 3F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant CDKN2A.
Immunogen
CDKN2A (AAH15960, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MMMGSAQVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (79)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDKN2A expression in transfected 293T cell line by CDKN2A monoclonal antibody (M06), clone 3F3.
Lane 1: CDKN2A transfected lysate (Predicted MW: 11.66 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDKN2A is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CDKN2A on HeLa cell . [antibody concentration 5 ug/ml] -
Gene Info — CDKN2A
Entrez GeneID
1029GeneBank Accession#
BC015960Protein Accession#
AAH15960Gene Name
CDKN2A
Gene Alias
ARF, CDK4I, CDKN2, CMM2, INK4, INK4a, MLM, MTS1, TP16, p14, p14ARF, p16, p16INK4, p16INK4a, p19
Gene Description
cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4)
Gene Ontology
HyperlinkGene Summary
This gene generates several transcript variants which differ in their first exons. At least three alternatively spliced variants encoding distinct proteins have been reported, two of which encode structurally related isoforms known to function as inhibitors of CDK4 kinase. The remaining transcript includes an alternate first exon located 20 Kb upstream of the remainder of the gene; this transcript contains an alternate open reading frame (ARF) that specifies a protein which is structurally unrelated to the products of the other variants. This ARF product functions as a stabilizer of the tumor suppressor protein p53 as it can interact with, and sequester, MDM1, a protein responsible for the degradation of p53. In spite of the structural and functional differences, the CDK inhibitor isoforms and the ARF product encoded by this gene, through the regulatory roles of CDK4 and p53 in cell cycle G1 progression, share a common functionality in cell cycle G1 control. This gene is frequently mutated or deleted in a wide variety of tumors, and is known to be an important tumor suppressor gene. [provided by RefSeq
Other Designations
CDK4 inhibitor p16-INK4|OTTHUMP00000021147|OTTHUMP00000021148|cell cycle negative regulator beta|cyclin-dependent kinase inhibitor 2A|cyclin-dependent kinase inhibitor p16|multiple tumor suppressor 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com