CDH1 monoclonal antibody (M01), clone 3F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CDH1 monoclonal antibody (M01), clone 3F4. Western Blot analysis of CDH1 expression in human kidney.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CDH1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.375 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDH1 is 0.1 ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between EGFR and CDH1. HeLa cells were stained with anti-EGFR rabbit purified polyclonal 1:1200 and anti-CDH1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDH1.
Immunogen
CDH1 (NP_004351, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CDH1 monoclonal antibody (M01), clone 3F4. Western Blot analysis of CDH1 expression in human kidney.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CDH1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.375 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDH1 is 0.1 ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between EGFR and CDH1. HeLa cells were stained with anti-EGFR rabbit purified polyclonal 1:1200 and anti-CDH1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — CDH1
Entrez GeneID
999GeneBank Accession#
NM_004360Protein Accession#
NP_004351Gene Name
CDH1
Gene Alias
Arc-1, CD324, CDHE, ECAD, LCAM, UVO
Gene Description
cadherin 1, type 1, E-cadherin (epithelial)
Gene Ontology
HyperlinkGene Summary
This gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid and ovarian cancer. Loss of function is thought to contribute to progression in cancer by increasing proliferation, invasion, and/or metastasis. The ectodomain of this protein mediates bacterial adhesion to mammalian cells and the cytoplasmic domain is required for internalization. Identified transcript variants arise from mutation at consensus splice sites. [provided by RefSeq
Other Designations
cadherin 1, E-cadherin (epithelial)|cadherin 1, type 1|calcium-dependent adhesion protein, epithelial|cell-CAM 120/80|uvomorulin
-
Interactome
-
Pathway
-
Disease
- Adenocarcinoma
- Asthma
- Breast cancer
- Breast Neoplasms
- Bronchiolitis
- Carcinoma
- Cleft Lip
- Cleft Palate
- Colitis
+ View More Disease
-
Publication Reference
-
Development of an AlphaLISA assay to quantify serum core-fucosylated E-cadherin as a metastatic lung adenocarcinoma biomarker.
Wen CL, Chen KY, Chen CT, Chuang JG, Yang PC, Chow LP.
Journal of Proteomics 2012 Jul; 75(13):3963.
Application：ELISA, Func, Human, Serum of lung adenocarcinoma patients.
-
Development of an AlphaLISA assay to quantify serum core-fucosylated E-cadherin as a metastatic lung adenocarcinoma biomarker.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com