CD3E monoclonal antibody (M04), clone 4C1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CD3E monoclonal antibody (M04), clone 4C1 Western Blot analysis of CD3E expression in HeLa ( Cat # L013V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD3E is approximately 1ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CD247 and CD3E. HeLa cells were stained with anti-CD247 rabbit purified polyclonal 1:1200 and anti-CD3E mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (46.09 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CD3E.
Immunogen
CD3E (AAH49847.1, 23 a.a. ~ 207 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (65); Rat (61)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (46.09 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CD3E monoclonal antibody (M04), clone 4C1 Western Blot analysis of CD3E expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD3E is approximately 1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CD247 and CD3E. HeLa cells were stained with anti-CD247 rabbit purified polyclonal 1:1200 and anti-CD3E mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — CD3E
Entrez GeneID
916GeneBank Accession#
BC049847Protein Accession#
AAH49847.1Gene Name
CD3E
Gene Alias
FLJ18683, T3E, TCRE
Gene Description
CD3e molecule, epsilon (CD3-TCR complex)
Omim ID
186830Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. [provided by RefSeq
Other Designations
CD3-epsilon|CD3E antigen, epsilon polypeptide|CD3e antigen, epsilon polypeptide (TiT3 complex)|T-cell antigen receptor complex, epsilon subunit of T3|T-cell surface antigen T3/Leu-4 epsilon chain|T-cell surface glycoprotein CD3 epsilon chain
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Circulating CD3+HLA-DR+ Extracellular Vesicles as a Marker for Th1/Tc1-Type Immune Responses.
Oba R, Isomura M, Igarashi A, Nagata K.
Journal of Immunology Research 2019 May; 2019:6720819.
Application：WB, Human, Extracellular vesicles from T cells.
-
Circulating CD3+HLA-DR+ Extracellular Vesicles as a Marker for Th1/Tc1-Type Immune Responses.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com