CBS purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CBS protein.
Immunogen
CBS (NP_000062.1, 1 a.a. ~ 551 a.a) full-length human protein.
Sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (84); Rat (84)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CBS MaxPab rabbit polyclonal antibody. Western Blot analysis of CBS expression in human pancreas.Western Blot (Tissue lysate)
CBS MaxPab rabbit polyclonal antibody. Western Blot analysis of CBS expression in mouse kidney.Western Blot (Transfected lysate)
Western Blot analysis of CBS expression in transfected 293T cell line (H00000875-T01) by CBS MaxPab polyclonal antibody.
Lane 1: CBS transfected lysate(60.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CBS
Entrez GeneID
875GeneBank Accession#
NM_000071.1Protein Accession#
NP_000062.1Gene Name
CBS
Gene Alias
HIP4
Gene Description
cystathionine-beta-synthase
Omim ID
236200Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. [provided by RefSeq
Other Designations
OTTHUMP00000109416|OTTHUMP00000109418|beta-thionase|cystathionine beta-synthase|methylcysteine synthase|serine sulfhydrase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
H2S stimulated bioenergetics in chicken erythrocytes and the underlying mechanism.
Zhuping Jin, Quanxi Zhang, Eden Wondimu, Richa Verma, Ming Fu, Tian Shuang, Hassan Mustafa Arif, Lingyun Wu, Rui Wang.
American Journal of Physiology. Regulatory, Integrative and Comparative Physiology 2020 Jul; 319(1):R69.
Application:WB-Ce, WB-Ti, Chicken, Mouse, Chicken erythrocytes, Mouse livers.
-
Discovery of a redox thiol switch: implications for cellular energy metabolism.
Gao X, Li L, Parisien M, Wu J, Bederman I, Gao Z, Krokowski D, Chirieleison SM, Abbott DW, Wang B, Arvan P, Cameron M, Chance M, Willard BB, Hatzoglou M.
Molecular & Cellular proteomics: MCP 2020 May; 19(5):852.
Application:WB-Ce, Human, Human immortalized human hepatocytes, Human pancreatic beta cells.
-
Coronary artery hypoxic vasorelaxation is augmented by perivascular adipose tissue through a mechanism involving hydrogen sulfide and cystathionine-β-synthase.
Donovan J, Wong PS, Garle MJ, Alexander SPH, Dunn WR, Ralevic V.
Acta Physiologica (Oxford, England) 2018 Jun; e13126.
Application:WB-Ti, Pig, Coronary artery, Myocardium, Perivascular adipose tissue.
-
Prenatal maternal stress induces visceral hypersensitivity of adult rat offspring through activation of cystathionine-β-synthase signaling in primary sensory neurons.
Wang HJ, Xu X, Xie RH, Rui YY, Zhang PA, Zhu XJ, Xu GY.
Molecular Pain 2018 Jan; 14:1744806918.
Application:WB, Rat, Dorsal root ganglion.
-
The viability of primary hepatocytes is maintained under a low cysteine-glutathione redox state with a marked elevation in ophthalmic acid production.
Lee J, Sil Kang E, Kobayashi S, Homma T, Sato H, Geuk Seo H, Fujii J.
Experimental Cell Research 2017 Dec; 361(1):178.
Application:WB-Ce, Mouse, Mouse primary hepatocytes.
-
Increased ophthalmic acid production is supported by amino acid catabolism under fasting conditions in mice.
Kobayashi S, Lee J, Takao T, Fujii J.
Biochemical and Biophysical Research Communications 2017 Jul; 491(3):649.
Application:WB-Ti, Mouse, Mouse liver.
-
Hydrogen sulfide protects against the development of experimental cerebral malaria in a C57BL/6 mouse model.
Jiang P, Xu Z, Xiao B, Han Z, Huang J, Xu J, Lun Z, Zhou W.
Molecular MedicineRreports 2017 Jun; 16(2):2045.
Application:WB-Ti, Mouse, Mouse brain.
-
Ascorbic acid prevents acetaminophen-induced hepatotoxicity in mice by ameliorating glutathione recovery and autophagy.
Kurahashi T, Lee J, Nabeshima A, Homma T, Kang ES, Saito Y, Yamada S, Nakayama T, Yamada KI, Miyata S, Fujii J.
Archives of Biochemistry and Biophysics 2016 Aug; 604:36.
Application:WB-Ti, Mouse, Liver.
-
Selectivity of commonly used pharmacological inhibitors for cystathionine beta synthase (CBS) and cystathionine gamma lyase (CSE).
Asimakopoulou A, Panopoulos P, Chasapis CT, Coletta C, Zhou Z, Cirino G, Giannis A, Szabo C, Spyroulias GA, Papapetropoulos A.
British Journal of Pharmacology 2013 Jun; 169(4):922.
Application:WB-Ti, Rat, Aorta, Brain.
-
Promoter demethylation of cystathionine-β-synthetase gene contributes to inflammatory pain in rats.
Qi F, Zhou Y, Xiao Y, Tao J, Gu J, Jiang X, Xu GY.
Pain 2012 Dec; 154(1):34.
Application:WB, Rat, dorsal root ganglia (DRG) neurons.
-
H2S stimulated bioenergetics in chicken erythrocytes and the underlying mechanism.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com