RUNX3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
RUNX3 MaxPab polyclonal antibody. Western Blot analysis of RUNX3 expression in human pancreas.
Western Blot (Transfected lysate)
Western Blot analysis of RUNX3 expression in transfected 293T cell line (H00000864-T01) by RUNX3 MaxPab polyclonal antibody.
Lane 1: RUNX3 transfected lysate(47.19 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to RUNX3 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to RUNX3 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RUNX3 protein.
Immunogen
RUNX3 (AAH13362.1, 1 a.a. ~ 429 a.a) full-length human protein.
Sequence
MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (91)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RUNX3 MaxPab polyclonal antibody. Western Blot analysis of RUNX3 expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of RUNX3 expression in transfected 293T cell line (H00000864-T01) by RUNX3 MaxPab polyclonal antibody.
Lane 1: RUNX3 transfected lysate(47.19 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to RUNX3 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to RUNX3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RUNX3
Entrez GeneID
864GeneBank Accession#
NM_001031680.2Protein Accession#
AAH13362.1Gene Name
RUNX3
Gene Alias
AML2, CBFA3, FLJ34510, MGC16070, PEBP2aC
Gene Description
runt-related transcription factor 3
Omim ID
600210Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5'-PYGPYGGT-3' found in a number of enhancers and promoters, and can either activate or suppress transcription. It also interacts with other transcription factors. It functions as a tumor suppressor, and the gene is frequently deleted or transcriptionally silenced in cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000003370|OTTHUMP00000003371|PEA2 alpha C|PEBP2 alpha C|acute myeloid leukemia gene 2|core-binding factor, runt domain, alpha subunit 3|polyomavirus enhancer-binding protein 2 alpha C subunit|transcription factor AML2
-
Interactome
-
Disease
-
Publication Reference
-
RUNX3 reverses cisplatin resistance in esophageal squamous cell carcinoma via suppression of the protein kinase B pathway.
Li DJ, Shi M, Wang Z.
Thoracic Cancer 2016 Sep; 7(5):570.
Application：IHC-P, Human, Esophageal squamous cell carcinoma.
-
Inactivation of RUNX3 predicts poor prognosis in esophageal squamous cell carcinoma after Ivor-Lewis esophagectomy.
Shi M, Wang Z, Liu XY, Chen D.
Medical Oncology 2014 Dec; 31(12):309.
Application：IHC-P, Human, Normal esophageal mucosa, Esophageal squamous cell carcinoma.
-
RUNX3 reverses cisplatin resistance in esophageal squamous cell carcinoma via suppression of the protein kinase B pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com