CAST MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CAST expression in transfected 293T cell line (H00000831-T01) by CAST MaxPab polyclonal antibody.
Lane 1: CAST transfected lysate(73.37 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to CAST on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CAST protein.
Immunogen
CAST (AAH13579, 1 a.a. ~ 667 a.a) full-length human protein.
Sequence
MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CAST expression in transfected 293T cell line (H00000831-T01) by CAST MaxPab polyclonal antibody.
Lane 1: CAST transfected lysate(73.37 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to CAST on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CAST
Entrez GeneID
831GeneBank Accession#
BC013579Protein Accession#
AAH13579Gene Name
CAST
Gene Alias
BS-17, MGC9402
Gene Description
calpastatin
Omim ID
114090Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length natures of only some have been determined. [provided by RefSeq
Other Designations
OTTHUMP00000158519|OTTHUMP00000158520|calpain inhibitor|heart-type calpastatin|sperm BS-17 component
-
Interactome
-
Disease
-
Publication Reference
-
Calpains play an essential role in mechanical ventilation-induced diaphragmatic weakness and mitochondrial dysfunction.
Hayden W Hyatt, Mustafa Ozdemir, Toshinori Yoshihara, Branden L Nguyen, Rafael Deminice, Scott K Powers.
Redox Biology 2021 Jan; 38:101802.
Application：WB, Rat, Diaphragm.
-
Calpains play an essential role in mechanical ventilation-induced diaphragmatic weakness and mitochondrial dysfunction.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com