C1QA purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human C1QA protein.
Immunogen
C1QA (NP_057075.1, 1 a.a. ~ 245 a.a) full-length human protein.
Sequence
MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
C1QA MaxPab rabbit polyclonal antibody. Western Blot analysis of C1QA expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of C1QA expression in transfected 293T cell line (H00000712-T03) by C1QA MaxPab polyclonal antibody.
Lane 1: C1QA transfected lysate(26.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — C1QA
Entrez GeneID
712GeneBank Accession#
NM_015991.2Protein Accession#
NP_057075.1Gene Name
C1QA
Gene Alias
-
Gene Description
complement component 1, q subcomponent, A chain
Omim ID
120550Gene Ontology
HyperlinkGene Summary
This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the A-chain polypeptide of human complement subcomponent C1q. [provided by RefSeq
Other Designations
OTTHUMP00000002936|complement component 1, q subcomponent, alpha polypeptide|complement component C1q, A chain
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com