BAD purified MaxPab rabbit polyclonal antibody (D01P)

Catalog # H00000572-D01P

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 376.00
Stock:
order now, ship in 3 months
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of BAD expression in transfected 293T cell line (H00000572-T01) by BAD MaxPab polyclonal antibody.

Lane 1: BAD transfected lysate(18.40 KDa).
Lane 2: Non-transfected lysate.

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between BAD and RAF1. HeLa cells were stained with anti-BAD rabbit purified polyclonal 1:1200 and anti-RAF1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between BAD and MAPK8. Mahlavu cells were stained with anti-BAD rabbit purified polyclonal 1:1200 and anti-MAPK8 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

  • Specification

    Product Description

    Rabbit polyclonal antibody raised against a full-length human BAD protein.MaxPab Polyclonal Antibody,MaxPab Polyclonal Antibodies,MaxPab,DNA Immune,DNA Immunization,Immune Technology

    Immunogen

    BAD (NP_004313.1, 1 a.a. ~ 168 a.a) full-length human protein.

    Sequence

    MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ

    Host

    Rabbit

    Reactivity

    Human

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Transfected lysate)

    Western Blot analysis of BAD expression in transfected 293T cell line (H00000572-T01) by BAD MaxPab polyclonal antibody.

    Lane 1: BAD transfected lysate(18.40 KDa).
    Lane 2: Non-transfected lysate.

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between BAD and RAF1. HeLa cells were stained with anti-BAD rabbit purified polyclonal 1:1200 and anti-RAF1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between BAD and MAPK8. Mahlavu cells were stained with anti-BAD rabbit purified polyclonal 1:1200 and anti-MAPK8 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Gene Info — BAD

    Entrez GeneID

    572

    GeneBank Accession#

    NM_004322

    Protein Accession#

    NP_004313.1

    Gene Name

    BAD

    Gene Alias

    BBC2, BCL2L8

    Gene Description

    BCL2-associated agonist of cell death

    Omim ID

    603167

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. [provided by RefSeq

    Other Designations

    BCL-X/BCL-2 binding protein|BCL2-antagonist of cell death protein|BCL2-binding component 6|BCL2-binding protein

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All