B2M monoclonal antibody (M01), clone 3F9-2C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant B2M.
Immunogen
B2M (AAH32589, 1 a.a. ~ 119 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Host
Mouse
Reactivity
Human
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.83 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
B2M monoclonal antibody (M01), clone 3F9-2C2 Western Blot analysis of B2M expression in U-2 OS ( Cat # L022V1 ).Western Blot (Transfected lysate)
Western Blot analysis of B2M expression in transfected 293T cell line by B2M monoclonal antibody (M01), clone 3F9-2C2.
Lane 1: B2M transfected lysate(13.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to B2M on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged B2M is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of B2M over-expressed 293 cell line, cotransfected with B2M Validated Chimera RNAi ( Cat # H00000567-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with B2M monoclonal antibody (M01), clone 3F9-2C2 (Cat # H00000567-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CALR and B2M. HeLa cells were stained with anti-CALR rabbit purified polyclonal 1:1200 and anti-B2M mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to B2M on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — B2M
Entrez GeneID
567GeneBank Accession#
BC032589Protein Accession#
AAH32589Gene Name
B2M
Gene Alias
-
Gene Description
beta-2-microglobulin
Gene Ontology
HyperlinkGene Summary
This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia
Other Designations
beta chain of MHC class I molecules|beta-2-microglobin
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Abundant CD8+ tumor infiltrating lymphocytes and beta-2-microglobulin are associated with better outcome and response to interleukin-2 therapy in advanced stage clear cell renal cell carcinoma.
Dale Davis, Maria S Tretiakova, Chris Kizzar, Randy Woltjer, Victoria Krajbich, Scott S Tykodi, Christian Lanciault, Nicole K Andeen.
Annals of Diagnostic Pathology 2020 Aug; 47:151537.
Application:IHC-P, Human, Human clear cell renal cell carcinoma.
-
MHC-I expression renders catecholaminergic neurons susceptible to T-cell-mediated degeneration.
Cebrian C, Zucca FA, Mauri P, Steinbeck JA, Studer L, Scherzer CR, Kanter E, Budhu S, Mandelbaum J, Vonsattel JP, Zecca L, Loike JD, Sulzer D.
Nature Communications 2014 Apr; 5:3633.
Application:IF, WB, Human, Brain.
-
Abundant CD8+ tumor infiltrating lymphocytes and beta-2-microglobulin are associated with better outcome and response to interleukin-2 therapy in advanced stage clear cell renal cell carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com