ATP6V0B purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ATP6V0B protein.
Immunogen
ATP6V0B (NP_004038.1, 1 a.a. ~ 205 a.a) full-length human protein.
Sequence
MTGLALLYSGVFVAFWACALAVGVCYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ATP6V0B expression in transfected 293T cell line (H00000533-T04) by ATP6V0B MaxPab polyclonal antibody.
Lane 1: ATP6V0B transfected lysate(21.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ATP6V0B
Entrez GeneID
533GeneBank Accession#
NM_004047.3Protein Accession#
NP_004038.1Gene Name
ATP6V0B
Gene Alias
ATP6F, HATPL, VMA16
Gene Description
ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b
Omim ID
603717Gene Ontology
HyperlinkGene Summary
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is part of the transmembrane V0 domain and is the human counterpart of yeast VMA16. Two alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq
Other Designations
ATPase, H+ transporting, lysosomal (vacuolar proton pump) 21kD|ATPase, H+ transporting, lysosomal 21kDa, V0 subunit c''|H(+)-transporting two-sector ATPase, subunit F|OTTHUMP00000010012|V-ATPase subunit c''|vacuolar ATP synthase 21 kDa proteolipid subunit
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com