APOA1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
APOA1 MaxPab polyclonal antibody. Western Blot analysis of APOA1 expression in human colon.
Western Blot (Transfected lysate)
Western Blot analysis of APOA1 expression in transfected 293T cell line (H00000335-T01) by APOA1 MaxPab polyclonal antibody.
Lane 1: APOA1 transfected lysate(29.37 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human APOA1 protein.
Immunogen
APOA1 (NP_000030.1, 1 a.a. ~ 267 a.a) full-length human protein.
Sequence
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
APOA1 MaxPab polyclonal antibody. Western Blot analysis of APOA1 expression in human colon.Western Blot (Transfected lysate)
Western Blot analysis of APOA1 expression in transfected 293T cell line (H00000335-T01) by APOA1 MaxPab polyclonal antibody.
Lane 1: APOA1 transfected lysate(29.37 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — APOA1
Entrez GeneID
335GeneBank Accession#
NM_000039Protein Accession#
NP_000030.1Gene Name
APOA1
Gene Alias
MGC117399
Gene Description
apolipoprotein A-I
Gene Ontology
HyperlinkGene Summary
This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The protein promotes cholesterol efflux from tissues to the liver for excretion, and it is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. [provided by RefSeq
Other Designations
OTTHUMP00000069346|OTTHUMP00000069347|OTTHUMP00000069348|apolipoprotein A1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com