AK2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human AK2 partial ORF ( NP_001616.1, 1 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.3
Interspecies Antigen Sequence
Mouse (94); Rat (93)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — AK2
Entrez GeneID
204GeneBank Accession#
NM_001625Protein Accession#
NP_001616.1Gene Name
AK2
Gene Alias
ADK2
Gene Description
adenylate kinase 2
Omim ID
103020Gene Ontology
HyperlinkGene Summary
Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
ATP-AMP transphosphorylase|OTTHUMP00000004287|OTTHUMP00000004288|adenylate kinase isoenzyme 2, mitochondrial|adenylate kinase, mitochondrial
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com