AK2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human AK2 protein.
Immunogen
AK2 (NP_001616.1, 1 a.a. ~ 239 a.a) full-length human protein.
Sequence
MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
AK2 MaxPab rabbit polyclonal antibody. Western Blot analysis of AK2 expression in human kidney.Western Blot (Tissue lysate)
AK2 MaxPab rabbit polyclonal antibody. Western Blot analysis of AK2 expression in mouse kidney.Western Blot (Transfected lysate)
Western Blot analysis of AK2 expression in transfected 293T cell line (H00000204-T01) by AK2 MaxPab polyclonal antibody.
Lane 1: AK2 transfected lysate(26.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — AK2
Entrez GeneID
204GeneBank Accession#
NM_001625.2Protein Accession#
NP_001616.1Gene Name
AK2
Gene Alias
ADK2
Gene Description
adenylate kinase 2
Omim ID
103020Gene Ontology
HyperlinkGene Summary
Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
ATP-AMP transphosphorylase|OTTHUMP00000004287|OTTHUMP00000004288|adenylate kinase isoenzyme 2, mitochondrial|adenylate kinase, mitochondrial
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com