ACTN1 monoclonal antibody (M01), clone 3F1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACTN1.
Immunogen
ACTN1 (NP_001093, 543 a.a. ~ 639 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (99)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ACTN1 expression in transfected 293T cell line by ACTN1 monoclonal antibody (M01), clone 3F1.
Lane 1: ACTN1 transfected lysate(103.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — ACTN1
Entrez GeneID
87GeneBank Accession#
NM_001102Protein Accession#
NP_001093Gene Name
ACTN1
Gene Alias
FLJ40884
Gene Description
actinin, alpha 1
Omim ID
102575Gene Ontology
HyperlinkGene Summary
Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, cytoskeletal, alpha actinin isoform and maps to the same site as the structurally similar erythroid beta spectrin gene. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
F-actin cross-linking protein|actinin 1 smooth muscle|alpha-actinin 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Rab13 Small G Protein and Junctional Rab13-binding Protein (JRAB) Orchestrate Actin Cytoskeletal Organization during Epithelial Junctional Development.
Sakane A, Abdallah AA, Nakano K, Honda K, Ikeda W, Nishikawa Y, Matsumoto M, Matsushita N, Kitamura T, Sasaki T.
The Journal of Biological Chemistry 2012 Oct; 287(51):42455.
Application:WB-Ce, Human, HEK293,MTD-1A cell.
-
alpha-actinin 1 and alpha-actinin 4: Contrasting roles in the survival, motility, and rhoa signaling of astrocytoma cells.
Quick Q, Skalli O.
Experimental Cell Research 2010 Apr; 316(7):1137.
Application:IF, WB, Human, Human brain tissues, A172, Hs683, U-87, U-118, U-373 cells.
-
Rab13 Small G Protein and Junctional Rab13-binding Protein (JRAB) Orchestrate Actin Cytoskeletal Organization during Epithelial Junctional Development.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com