ACAA1 monoclonal antibody (M01), clone 3F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in human liver.
Western Blot (Cell lysate)
ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in A-431.
Western Blot (Cell lysate)
ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in PC-12.
Western Blot (Transfected lysate)
Western Blot analysis of ACAA1 expression in transfected 293T cell line by ACAA1 monoclonal antibody (M01), clone 3F11.
Lane 1: ACAA1 transfected lysate (Predicted MW: 44.3 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ACAA1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACAA1 is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to ACAA1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACAA1.
Immunogen
ACAA1 (NP_001598, 217 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPD
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (85); Rat (86)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in human liver.Western Blot (Cell lysate)
ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in A-431.Western Blot (Cell lysate)
ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in PC-12.Western Blot (Transfected lysate)
Western Blot analysis of ACAA1 expression in transfected 293T cell line by ACAA1 monoclonal antibody (M01), clone 3F11.
Lane 1: ACAA1 transfected lysate (Predicted MW: 44.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ACAA1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACAA1 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ACAA1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — ACAA1
Entrez GeneID
30GeneBank Accession#
NM_001607Protein Accession#
NP_001598Gene Name
ACAA1
Gene Alias
ACAA, PTHIO, THIO
Gene Description
acetyl-Coenzyme A acyltransferase 1
Gene Ontology
HyperlinkGene Summary
This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
peroxisomal 3-oxoacyl-Coenzyme A thiolase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com