GAPDH polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with GAPDH polyclonal antibody (Cat # PAB27869) at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach, lower with GAPDH polyclonal antibody (Cat # PAB27869) shows strong nuclear and cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with GAPDH polyclonal antibody (Cat # PAB27869) at 1-4 ug/mL dilution shows positivity in plasma membrane & cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant GAPDH.
Immunogen
Recombinant protein corresponding to amino acids of human GAPDH.
Sequence
TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with GAPDH polyclonal antibody (Cat # PAB27869) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach, lower with GAPDH polyclonal antibody (Cat # PAB27869) shows strong nuclear and cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with GAPDH polyclonal antibody (Cat # PAB27869) at 1-4 ug/mL dilution shows positivity in plasma membrane & cytoplasm. -
Gene Info — GAPDH
Entrez GeneID
2597Gene Name
GAPDH
Gene Alias
G3PD, GAPD, MGC88685
Gene Description
glyceraldehyde-3-phosphate dehydrogenase
Omim ID
138400Gene Ontology
HyperlinkGene Summary
The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. [provided by RefSeq
Other Designations
OTTHUMP00000174431|OTTHUMP00000174432|aging-associated gene 9 protein|glyceraldehyde 3-phosphate dehydrogenase
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Glycolysis / Gluconeogenesis
- Metabolic pathways
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com