Product Browser

Last updated: 2015/8/30

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IFNG (Human) Recombinant ProteinBioActive

  • Catalog # : P4400
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IFNG (P01579) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 16.88
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the viral resistance assay using L929 cells is 5.8-8.8x107 Units/mg. The expected ED50 for this effect is 0.01-0.02 ng/mL.
  • Storage Buffer:
  • Lyophilized from 5 mM Na2PO4, 50 mM NaCl, pH 7.2
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis
  • The specific activity, as determined in a viral challenge assay using EMC virus on L929 cells, is 5.8-8.64 x 107 Units/mg. The corresponding ED50 is 0.02-0.011 ng/mL.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3458
  • Gene Name:
  • IFNG
  • Gene Alias:
  • IFG,IFI
  • Gene Description:
  • interferon, gamma
  • Gene Summary:
  • Interferon-gamma (IFNG), or type II interferon, is a cytokine critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFNG expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFNG in the immune system stems in part from its ability to inhibit viral replication directly, but most importantly derives from its immunostimulatory and immunomodulatory effects. IFNG is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 (MIM 186940) and CD8 (see MIM 186910) cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops (Schoenborn and Wilson, 2007 [PubMed 17981204]).[supplied by OMIM
  • Other Designations:
  • -
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook