Product Browser

Last updated: 2015/3/29

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL8 (Human) Recombinant ProteinBioActive

  • Catalog # : P3641
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL8 (P10145, 28 a.a. - 99 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 95% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 10.0-100.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3576
  • Gene Name:
  • IL8
  • Gene Alias:
  • CXCL8,GCP-1,GCP1,LECT,LUCT,LYNAP,MDNCF,MONAP,NAF,NAP-1,NAP1
  • Gene Description:
  • interleukin 8
  • Gene Summary:
  • The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. [provided by RefSeq
  • Other Designations:
  • T cell chemotactic factor,beta-thromboglobulin-like protein,chemokine (C-X-C motif) ligand 8,emoctakin,granulocyte chemotactic protein 1,lymphocyte-derived neutrophil-activating factor,monocyte-derived neutrophil chemotactic factor,neutrophil-activating p
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook