Product Browser

Last updated: 2015/4/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ADIPOQ (Human) Recombinant Protein

  • Catalog # : P3520
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ADIPOQ (NP_004788, 15 a.a. - 244 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 25.1
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Endotoxin Level:
  • < 1.0 EU per 1 ug of protein (determined by LAL method)
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3520
  • Storage Buffer:
  • In PBS, pH 7.4 (1 mM dithiothreitol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 9370
  • Gene Name:
  • ADIPOQ
  • Gene Alias:
  • ACDC,ACRP30,ADPN,APM-1,APM1,GBP28,adiponectin
  • Gene Description:
  • adiponectin, C1Q and collagen domain containing
  • Gene Summary:
  • This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. [provided by RefSeq
  • Other Designations:
  • adipocyte, C1Q and collagen domain containing,adipocyte, C1Q and collagen domain-containing,adiponectin,adipose most abundant gene transcript 1,gelatin-binding protein 28
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook