ZNF772 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ZNF772 MaxPab polyclonal antibody. Western Blot analysis of ZNF772 expression in rat brain.
Western Blot (Tissue lysate)
ZNF772 MaxPab polyclonal antibody. Western Blot analysis of ZNF772 expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of ZNF772 expression in transfected 293T cell line (H00400720-T01) by ZNF772 MaxPab polyclonal antibody.
Lane 1: ZNF772 transfected lysate(53.79 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ZNF772 protein.
Immunogen
ZNF772 (AAI60024.1, 1 a.a. ~ 489 a.a) full-length human protein.
Sequence
MAAAEPMGPAQVPMNSEVIVDPIQGQVNFEDVFVYFSQEEWVLLDEAQRLLYRDVMLENFALMASLGHTSFMSHIVASLVMGSEPWVPDWVDMTLAVATETPGGSDPGCWHGMEDEEIPFEQSFSIGMSQIRIPKGGPSTQKAYPCGTCGLVLKDILHLAEHQETHPGQKPYMCVLCGKQFCFSANLHQHQKQHSGEKPFRSDKSRPFLLNNCAVQSMEMSFVTGEACKDFLASSSIFEHHAPHNEWKPHSNTKCEEASHCGKRHYKCSECGKTFSRKDSLVQHQRVHTGERPYECGECGKTFSRKPILAQHQRIHTGEMPYECGICGKVFNHSSNLIVHQRVHTGARPYKCSECGKAYSHKSTLVQHESIHTGERPYECSECGKYFGHKYRLIKHWSVHTGARPYECIACGKFFSQSSDLIAHQRVHNGEKPYVCSECGKAFSHKHVLVQHHRIHTGERPYKCSECGKAFRQRASLIRHWKIHTGERP
Host
Mouse
Reactivity
Human, Rat
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ZNF772 MaxPab polyclonal antibody. Western Blot analysis of ZNF772 expression in rat brain.Western Blot (Tissue lysate)
ZNF772 MaxPab polyclonal antibody. Western Blot analysis of ZNF772 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of ZNF772 expression in transfected 293T cell line (H00400720-T01) by ZNF772 MaxPab polyclonal antibody.
Lane 1: ZNF772 transfected lysate(53.79 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ZNF772
Entrez GeneID
400720GeneBank Accession#
BC160024.1Protein Accession#
AAI60024.1Gene Name
ZNF772
Gene Alias
DKFZp686I1569
Gene Description
zinc finger protein 772
Gene Ontology
HyperlinkOther Designations
-
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com