LRG1 monoclonal antibody (M01), clone 2E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant LRG1.
Immunogen
LRG1 (AAH34389, 37 a.a. ~ 347 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TLSPKDCQVFRPDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQRDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66); Rat (64)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (59.95 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LRG1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — LRG1
Entrez GeneID
116844GeneBank Accession#
BC034389Protein Accession#
AAH34389Gene Name
LRG1
Gene Alias
HMFT1766, LRG
Gene Description
leucine-rich alpha-2-glycoprotein 1
Omim ID
611289Gene Ontology
HyperlinkGene Summary
The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al., 2002 [PubMed 12223515]).[supplied by OMIM
Other Designations
1300008B03Rik|2310031E04Rik|leucine rich alpha 2 glycoprotein
-
Interactome
-
Publication Reference
-
Intracellular leucine-rich alpha-2-glycoprotein-1 competes with Apaf-1 for binding cytochrome c in protecting MCF-7 breast cancer cells from apoptosis.
Ronald Jemmerson, Katherine Staskus, LeeAnn Higgins, Kathleen Conklin, Ameeta Kelekar.
Apoptosis 2021 Feb; 26(1-2):71.
Application:WB-Ce, WB-Tr, Human, HMECs, Human serum, MCF-7, MDA-MB-231, MDA-MB-435, T-47D cells.
-
Type 1 Diabetes: Urinary Proteomics and Protein Network Analysis Support Perturbation of Lysosomal Function.
Singh H, Yu Y, Suh MJ, Torralba MG, Stenzel RD, Tovchigrechko A, Thovarai V, Harkins DM, Rajagopala SV, Osborne W, Cogen FR, Kaplowitz PB, Nelson KE, Madupu R, Pieper R.
Theranostics 2017 Jul; 7(10):2704.
Application:WB-Re, Recombinant protein.
-
Leucine Rich α-2 Glycoprotein: A Novel Neutrophil Granule Protein and Modulator of Myelopoiesis.
Druhan LJ, Lance A, Li S, Price AE, Emerson JT, Baxter SA, Gerber JM, Avalos BR.
PLoS One 2017 Jan; 12(1):e0170261.
Application:IF, WB, Human, HL-60 cells, Neutrophils from the peripheral blood of healthy donors.
-
Proteomic profiling for the identification of serum diagnostic biomarkers for abdominal and thoracic aortic aneurysms.
Satoh K, Maniwa T, Oda T, Matsumoto K.
Proteome Science 2013 Jun; 11(1):27.
Application:WB, Human, Human serum.
-
MiRNA-335 suppresses neuroblastoma cell invasiveness by direct targeting of multiple genes from the non-canonical TGF-β signalling pathway.
Lynch J, Fay J, Meehan M, Bryan K, Watters KM, Murphy DM, Stallings RL.
Carcinogenesis 2012 May; 33(5):976.
Application:WB-Tr, Human, CHP-212 cells.
-
Intracellular leucine-rich alpha-2-glycoprotein-1 competes with Apaf-1 for binding cytochrome c in protecting MCF-7 breast cancer cells from apoptosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com