SLC22A12 monoclonal antibody (M02), clone 2B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SLC22A12 monoclonal antibody (M02), clone 2B5. Western Blot analysis of SLC22A12 expression in human stomach.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC22A12 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.33 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SLC22A12.
Immunogen
SLC22A12 (NP_653186.2, 281 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (74)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.33 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SLC22A12 monoclonal antibody (M02), clone 2B5. Western Blot analysis of SLC22A12 expression in human stomach.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC22A12 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SLC22A12
Entrez GeneID
116085GeneBank Accession#
NM_144585Protein Accession#
NP_653186.2Gene Name
SLC22A12
Gene Alias
OAT4L, RST, URAT1
Gene Description
solute carrier family 22 (organic anion/urate transporter), member 12
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a urate transporter and urate-anion exchanger which regulates the level of urate in the blood. This protein is an integral membrane protein primarily found in kidney. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000042665|organic anion transporter 4-like|solute carrier family 22 (organic anion/cation transporter), member 12|solute carrier family 22 member 12|urate anion exchanger 1|urate transporter 1
-
Disease
-
Publication Reference
-
Taurine Inhibited Uric Acid Uptake in HK-2 Renal Tubular Epithelial Cells.
Feng Y, Lin S, Zhao X, Yang Q, Wu G, Lv Q, Yang J, Hu J.
Advances in Experimental Medicine and Biology 2019 Aug; 1155:147.
Application：WB-Ce, Human, HK-2 cells.
-
The polymorphism rs35767 at IGF1 locus is associated with serum urate levels.
Mannino GC, Fuoco A, Marini MA, Spiga R, Di Fatta C, Mancuso E, Perticone F, Andreozzi F, Sesti G.
Scientific Reports 2018 Aug; 8(1):12255.
Application：WB-Ce, Human, HEK293 cells.
-
OIT3 deficiency impairs uric acid reabsorption in renal tubule.
Yan B, Zhang ZZ, Huang LY, Shen HL, Han ZG.
FEBS Letters 2012 Mar; 586(6):760.
Application：WB-Ti, Mouse, Kidney.
-
Sucrose induces fatty liver and pancreatic inflammation in male breeder rats independent of excess energy intake.
Roncal-Jimenez CA, Lanaspa MA, Rivard CJ, Nakagawa T, Sanchez-Lozada LG, Jalal D, Andres-Hernando A, Tanabe K, Madero M, Li N, Cicerchi C, Mc Fann K, Sautin YY, Johnson RJ.
Metabolism 2011 Apr; 60:1259.
Application：IF, WB-Ti, Rat, Pancreatic islets, Blood vessels.
-
Taurine Inhibited Uric Acid Uptake in HK-2 Renal Tubular Epithelial Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com