TNFRSF13C purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TNFRSF13C protein.
Immunogen
TNFRSF13C (NP_443177.1, 1 a.a. ~ 184 a.a) full-length human protein.
Sequence
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TNFRSF13C MaxPab rabbit polyclonal antibody. Western Blot analysis of TNFRSF13C expression in mouse kidney.Western Blot (Transfected lysate)
Western Blot analysis of TNFRSF13C expression in transfected 293T cell line (H00115650-T02) by TNFRSF13C MaxPab polyclonal antibody.
Lane 1: TNFRSF13C transfected lysate(18.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TNFRSF13C
Entrez GeneID
115650GeneBank Accession#
NM_052945.2Protein Accession#
NP_443177.1Gene Name
TNFRSF13C
Gene Alias
BAFF-R, BAFFR, CD268, MGC138235
Gene Description
tumor necrosis factor receptor superfamily, member 13C
Omim ID
606269Gene Ontology
HyperlinkGene Summary
B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival. [provided by RefSeq
Other Designations
B cell-activating factor receptor|BAFF receptor|OTTHUMP00000028746
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com