ADPGK (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ADPGK partial ORF ( NP_112574, 425 a.a. - 496 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33.66
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ADPGK
Entrez GeneID
83440GeneBank Accession#
NM_031284Protein Accession#
NP_112574Gene Name
ADPGK
Gene Alias
2610017G09Rik, ADP-GK, DKFZp434B195
Gene Description
ADP-dependent glucokinase
Gene Ontology
HyperlinkGene Summary
ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]).[supplied by OMIM
Other Designations
ATP-dependent glucokinase
-
Interactome
-
Disease
-
Publication Reference
-
Deletion of genes involved in the ketogluconate metabolism, Entner-Doudoroff pathway, and glucose dehydrogenase increase local and invasive virulence phenotypes in Streptococcus pneumoniae.
Hu FZ, Król JE, Tsai CHS, Eutsey RA, Hiller LN, Sen B, Ahmed A, Hillman T, Buchinsky FJ, Nistico L, Dice B, Longwell M, Horsey E, Ehrlich GD.
PLoS One 2019 Jan; 14(1):e0209688.
Application:Func, Recombinant protein.
-
Expression and role in glycolysis of human ADP-dependent glucokinase.
Richter S, Richter JP, Mehta SY, Gribble AM, Sutherland-Smith AJ, Stowell KM, Print CG, Ronimus RS, Wilson WR.
Molecular and Cellular Biochemistry 2012 Jan; 364(1-2):131.
Application:WB, Human, As a control.
-
Deletion of genes involved in the ketogluconate metabolism, Entner-Doudoroff pathway, and glucose dehydrogenase increase local and invasive virulence phenotypes in Streptococcus pneumoniae.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com