ADPGK monoclonal antibody (M01), clone 1E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ADPGK.
Immunogen
ADPGK (NP_112574, 425 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.66 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ADPGK monoclonal antibody (M01), clone 1E4. Western Blot analysis of ADPGK expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
ADPGK monoclonal antibody (M01), clone 1E4 Western Blot analysis of ADPGK expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
ADPGK monoclonal antibody (M01), clone 1E4. Western Blot analysis of ADPGK expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
ADPGK monoclonal antibody (M01), clone 1E4. Western Blot analysis of ADPGK expression in PC-12(Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ADPGK expression in transfected 293T cell line by ADPGK monoclonal antibody (M01), clone 1E4.
Lane 1: ADPGK transfected lysate(54.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ADPGK is 0.3 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ADPGK over-expressed 293 cell line, cotransfected with ADPGK Validated Chimera RNAi ( Cat # H00083440-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ADPGK monoclonal antibody (M01), clone 1E4 (Cat # H00083440-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — ADPGK
Entrez GeneID
83440GeneBank Accession#
NM_031284Protein Accession#
NP_112574Gene Name
ADPGK
Gene Alias
2610017G09Rik, ADP-GK, DKFZp434B195
Gene Description
ADP-dependent glucokinase
Gene Ontology
HyperlinkGene Summary
ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]).[supplied by OMIM
Other Designations
ATP-dependent glucokinase
-
Interactome
-
Disease
-
Publication Reference
-
Zinc Finger Nuclease Mediated Knockout of ADP-Dependent Glucokinase in Cancer Cell Lines: Effects on Cell Survival and Mitochondrial Oxidative Metabolism.
Susan Ric.hter, Shona Morrison, Tim Connor, Jiechuang Su, Cristin G Print, Ron S Ronimus, Sean L McGee, William R Wilson
PLoS One 2013 Jun; 8(6):e65267.
Application:WB-Ti, WB-Tr, Human, Mouse, HCT-116 cells, HCT-116-tumor xenografts from mice, Mouse liver, NCI-H460 cells.
-
Expression and role in glycolysis of human ADP-dependent glucokinase.
Richter S, Richter JP, Mehta SY, Gribble AM, Sutherland-Smith AJ, Stowell KM, Print CG, Ronimus RS, Wilson WR.
Molecular and Cellular Biochemistry 2012 Jan; 364(1-2):131.
Application:WB, Human, SiHa, C33A, H460, H1299, A549, HT29, HCT116, MDA231, MiaPaca2, A2780, PC3, 22Rv1, HepG2, SCOV3, HCT8,A431, Panc01, H522, Hep3B, Dl145, FaDu, H69, H82.
-
Zinc Finger Nuclease Mediated Knockout of ADP-Dependent Glucokinase in Cancer Cell Lines: Effects on Cell Survival and Mitochondrial Oxidative Metabolism.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com