NDRG4 monoclonal antibody (M01), clone 2G3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NDRG4 monoclonal antibody (M01), clone 2G3. Western Blot analysis of NDRG4 expression in Raw 264.7.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NDRG4 on formalin-fixed paraffin-embedded human colon adenocarcinoma. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NDRG4 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (63.03 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NDRG4.
Immunogen
NDRG4 (AAH11795.1, 1 a.a. ~ 339 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTMEVSC
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (93); Rat (92)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (63.03 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NDRG4 monoclonal antibody (M01), clone 2G3. Western Blot analysis of NDRG4 expression in Raw 264.7.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NDRG4 on formalin-fixed paraffin-embedded human colon adenocarcinoma. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NDRG4 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — NDRG4
Entrez GeneID
65009GeneBank Accession#
BC011795Protein Accession#
AAH11795.1Gene Name
NDRG4
Gene Alias
DKFZp686I1615, FLJ30586, FLJ42011, KIAA1180, MGC19632, SMAP-8
Gene Description
NDRG family member 4
Gene Ontology
HyperlinkGene Summary
This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
smooth muscle-associated protein 8
-
Interactome
-
Disease
-
Publication Reference
-
NDRG4, an early detection marker for colorectal cancer, is specifically expressed in enteric neurons.
Vaes N, Lentjes MHFM, Gijbels MJ, Rademakers G, Daenen KL, Boesmans W, Wouters KAD, Geuzens A, Qu X, Steinbusch HPJ, Rutten BPF, Baldwin SH, Sharkey KA, Hofstra RMW, van Engeland M, Vanden Berghe P, Melotte V.
Neurogastroenterol Motil 2017 Sep; 29(9).
Application：IF, IHC-P, WB-Ti, Human, Mouse, Human colonic specimens, Mouse brain, colon, heart tissues.
-
Uterine Expression of NDRG4 Is Induced by Estrogen and Up-Regulated during Embryo Implantation Process in Mice.
Yang Q, Gu Y, Zhang X, Wang JM, He YP, Shi Y, Sun ZG, Shi HJ, Wang J.
PLoS One 2016 May; 11(5):e0155491.
Application：IHC-P, Mouse, Uterine.
-
NDRG4 is downregulated in glioblastoma and inhibits cell proliferation.
Ding W, Zhang J, Yoon JG, Shi D, Foltz G, Lin B.
Omics : a Journal of Integrative Biology 2012 May; 16(5):263.
Application：WB-Ti, Human, Brain from patients with glioblastoma multiforme, normal brain tissues.
-
N-Myc Downstream-Regulated Gene 4 (NDRG4): A Candidate Tumor Suppressor Gene and Potential Biomarker for Colorectal Cancer.
Melotte V, Lentjes MH, van den Bosch SM, Hellebrekers DM, de Hoon JP, Wouters KA, Daenen KL, Partouns-Hendriks IE, Stessels F, Louwagie J, Smits KM, Weijenberg MP, Sanduleanu S, Khalid-de Bakker CA, Oort FA, Meijer GA, Jonkers DM, Herman JG, de Bruine AP,.
Journal of the National Cancer Institute 2009 Jul; 101(13):916.
Application：IHC-P, Human, Human colorectal cancer.
-
Identification and action of N-myc downstream regulated gene 4 A2 in rat pancreas.
Wang JF, Hill DJ.
The Journal of Endocrinology 2009 Apr; 201(1):15.
Application：ICC, IHC-P, WB-Tr, Rat, ARIP cells, Rat pancreatic ducts.
-
NDRG4, an early detection marker for colorectal cancer, is specifically expressed in enteric neurons.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com