Product Browser

Last updated: 2014/4/21
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

BIRC6 polyclonal antibody (A01)

  • Catalog # : H00057448-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BIRC6.
  • Immunogen:
  • BIRC6 (NP_057336, 31 a.a. ~ 140 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RDGCMHCDADGLHSLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALSAKPGGQVKCQYISAVDKVIFVDDYAVGCRKDLNGILLLDTALQTPVSKQDDVVQLELPVT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • BIRC6
  • Gene Alias:
  • APOLLON,BRUCE,FLJ13726,FLJ13786,KIAA1289
  • Gene Description:
  • baculoviral IAP repeat-containing 6
  • Gene Summary:
  • This gene encodes a protein with a BIR (baculoviral inhibition of apoptosis protein repeat) domain and a UBCc (ubiquitin-conjugating enzyme E2, catalytic) domain. This protein inhibits apoptosis by facilitating the degradation of apoptotic proteins by ubiquitination. [provided by RefSeq
  • Other Designations:
  • ubiquitin-conjugating BIR-domain enzyme apollon
  • RSS
  • YouTube
  • Linkedin
  • Facebook