Product Browser

Last updated: 2014/4/14
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

AKR1B10 monoclonal antibody (M03), clone 2B3

  • Catalog # : H00057016-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant AKR1B10.
  • Immunogen:
  • AKR1B10 (NP_064695, 76 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00057016-M03
    Western Blot detection against Immunogen (33.22 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • AKR1B10 monoclonal antibody (M03), clone 2B3. Western Blot analysis of AKR1B10 expression in HepG2 ( Cat # L019V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • AKR1B10
  • Gene Alias:
  • AKR1B11,AKR1B12,ALDRLn,ARL-1,ARL1,HIS,HSI,MGC14103
  • Gene Description:
  • aldo-keto reductase family 1, member B10 (aldose reductase)
  • Gene Summary:
  • This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. [provided by RefSeq
  • Other Designations:
  • aldo-keto reductase family 1, member B10,aldo-keto reductase family 1, member B11 (aldose reductase-like),aldose reductase-like 1,aldose reductase-like peptide,aldose reductase-related protein,small intestine reductase
  • RSS
  • YouTube
  • Linkedin
  • Facebook